PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.003G189700.1
Common NamePOPTR_0003s18900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 569aa    MW: 62101.9 Da    PI: 4.852
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.003G189700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-173986148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT  Ed +l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Potri.003G189700.1 39 KGPWTSAEDAILIEYVKKHGEGNWNSVQKHSGLFRCGKSCRLRWANHL 86
                        79******************************************9986 PP

2Myb_DNA-binding52.31.3e-1692135146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++T eE++l++++++++G++ W++ a++++ gRt++++k++w++
  Potri.003G189700.1  92 KGAFTHEEEQLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 135
                         799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1723486IPR017930Myb domain
SuperFamilySSF466898.99E-3136133IPR009057Homeodomain-like
SMARTSM007171.5E-153888IPR001005SANT/Myb domain
PfamPF002491.5E-153986IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-244093IPR009057Homeodomain-like
CDDcd001674.31E-124186No hitNo description
PROSITE profilePS5129426.56887141IPR017930Myb domain
SMARTSM007171.1E-1691139IPR001005SANT/Myb domain
PfamPF002491.1E-1592135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-2694140IPR009057Homeodomain-like
CDDcd001673.83E-1294135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MSRTTSESED GMISKDQTGL PLGEEGSYGG STNGVGLKKG PWTSAEDAIL IEYVKKHGEG  60
NWNSVQKHSG LFRCGKSCRL RWANHLRPNL KKGAFTHEEE QLIIELHAKM GNKWARMAAH  120
LPGRTDNEIK NYWNTRIKRR QRAGLPLYPP EVSLQTLQGS QQCLDINGMD SGNKGQHDIL  180
QTHNYGIPDV MFDNLKTNRS ILPYVPELPD ISASSILMKG LCSSQYGSFM SPTMHRQKRL  240
REATTLLSSF SGGMKNDFHL FDQFQDGDKA AQYFGLSFPF DPDSATKNPE IFGENQGSHT  300
LANGDFSASK PTSEAVKFEL PSLQYAETDL GGWGASCSPS PLIESVDTFI QSPPTGTVES  360
NFPSPRNSGL LDALLYEART LSSAKNQSSD KSSNSSTITP GDNADCSALN ISETEWEDYG  420
DPISPLGHPA ASLFSECTPI SASGSSLDES PPTETLTGSK RKFGCSSECN MKLEPVDHTW  480
TADREKESYT QLDITRPDAL LDSDWLEHDS GYGKDQVIMT EAIATLLGDD LSSEYKQMAA  540
GASTDHGWGL GSCSWNNMPA VCQMSELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-32371405107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304822.20.0hypothetical protein POPTR_0003s18900g
RefseqXP_006385964.10.0hypothetical protein POPTR_0003s18900g
TrEMBLB9GXK60.0B9GXK6_POPTR; Uncharacterized protein
STRINGPOPTR_0003s18900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-139myb domain protein 33